PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG553000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 645aa    MW: 68915.3 Da    PI: 8.0651
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG553000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox542.9e-171421556
                         HHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox 15 LeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                         +e++F+++++p++++r++L+++lgL+ rqVk+WFqNrR++ k
  Pavir.5KG553000.1.p  1 MEAVFKESPHPDEKQRQQLSQELGLSARQVKFWFQNRRTQIK 42
                         799***********************************9877 PP

2START171.17.5e-541543779206
                          HHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
                START   9 elvkkalaeepgWvkss....esengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                          el ++ +a+ep+Wv+s     + +n+de+ ++f++++             s+ea+r++gvv+ ++++lv+ ++d + qW e ++    ka
  Pavir.5KG553000.1.p 154 ELTAMCSAGEPLWVRSLetgrDVLNYDEYARRFQRGGDdpagggeqragWSVEASRETGVVFLDTTQLVNAFMDAN-QWMELFPtmisKA 242
                          788999***************************88777**************************************.99999999999** PP

                          EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCE CS
                START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksngh 161
                          +tl+vi+ g      g++qlm+ae q l+plvp R+  f+R++++l+a++w++vdvSvd+ ++    ss   ++ + pSg++ie+  ng+
  Pavir.5KG553000.1.p 243 ATLAVIRAGqnddkdGVVQLMFAEVQTLTPLVPtRELSFLRHCKKLTADKWAVVDVSVDNVEPDARtSSTASKCLKKPSGCVIEEQTNGR 332
                          *************************************************************9999889999******************* PP

                          EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +kvtwveh+ ++ + ++++ r+   sgl +ga++wva+l+ qce+
  Pavir.5KG553000.1.p 333 CKVTWVEHATCRNAAVPSMCRPAAASGLTFGARRWVAALRLQCER 377
                          *******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.374144IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-15151IPR009057Homeodomain-like
SuperFamilySSF466897.52E-14148IPR009057Homeodomain-like
CDDcd000861.11E-14145No hitNo description
SMARTSM003893.3E-7148IPR001356Homeobox domain
PfamPF000461.1E-14142IPR001356Homeobox domain
PROSITE patternPS0002701942IPR017970Homeobox, conserved site
SMARTSM002346.1E-37147377IPR002913START domain
PROSITE profilePS5084834.356152380IPR002913START domain
SuperFamilySSF559612.27E-25153377No hitNo description
CDDcd088755.17E-89154376No hitNo description
PfamPF018526.7E-43154377IPR002913START domain
Gene3DG3DSA:3.30.530.203.7E-5200346IPR023393START-like domain
SuperFamilySSF559611.41E-7399487No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010062Biological Processnegative regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MEAVFKESPH PDEKQRQQLS QELGLSARQV KFWFQNRRTQ IKATQERHEN ALLKSELEKL  60
QGENRAMREL AKKSPRCPGC GAAAAASTEE QQLRLENAML KAEVERLRGT LGTPAADELA  120
VAAPASPSRS ARAIRIGCGG GGGLSGHDRT RILELTAMCS AGEPLWVRSL ETGRDVLNYD  180
EYARRFQRGG DDPAGGGEQR AGWSVEASRE TGVVFLDTTQ LVNAFMDANQ WMELFPTMIS  240
KAATLAVIRA GQNDDKDGVV QLMFAEVQTL TPLVPTRELS FLRHCKKLTA DKWAVVDVSV  300
DNVEPDARTS STASKCLKKP SGCVIEEQTN GRCKVTWVEH ATCRNAAVPS MCRPAAASGL  360
TFGARRWVAA LRLQCERMVF SVATNIPARD SAGVATLAGR RSVLKLAHRM ASSLCRVIGG  420
SRGLAWSGQA SNSGGVRVTS RRNAGDDPGE PCGLVACAVL SAWLPVNPAA LLDFLRDASR  480
RHEWDVMLPP GRPVRSRVSV AKGKDRGNCV TAYAPGEQDG EWILQDSSTG PCESTVAYAP  540
VDAAALRAVI DGHDSSGVAV LPCGFAVMPD GLECRPAVIT SCRKEEEENR AAACGALVTV  600
AFQALASMSP ANDGALPQDA AETVAGLASC ALGNIKRALR CEGR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankPNIAATA1e-128D25322.1 Panicum miliaceum gene for cytosolic aspartate aminotransferase, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701492.10.0PREDICTED: homeobox-leucine zipper protein ROC9
SwissprotQ5JMF30.0ROC9_ORYSJ; Homeobox-leucine zipper protein ROC9
TrEMBLK3XSK50.0K3XSK5_SETIT; Uncharacterized protein
STRINGSi004904m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.10.0HD-ZIP family protein